PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00013.53
Common NameAMTR_s00013p00103080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family MIKC_MADS
Protein Properties Length: 242aa    MW: 27357 Da    PI: 8.5778
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00013.53genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.42.5e-30959151
                                             S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                                   SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                             krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gk ye++s
  evm_27.model.AmTr_v1.0_scaffold00013.53  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKQYEFCS 59
                                             79***********************************************96 PP

2K-box101.61e-3378172599
                                    K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnelll 74 
                                              + + +++++++s+qqe+ +Lk+  e Lqr+qR+llGedL++Ls keL+qLeqqL+ slk+iRs K+++++
  evm_27.model.AmTr_v1.0_scaffold00013.53  78 QETTVSTKETQSSQQEYLRLKAHFEALQRSQRNLLGEDLGPLSGKELEQLEQQLDMSLKQIRSIKTQYMI 147
                                              455589999************************************************************* PP

                                    K-box  75 eqieelqkkekelqeenkaLrkkle 99 
                                              +q+ +lq+ke++l+e n+aL++kle
  evm_27.model.AmTr_v1.0_scaffold00013.53 148 DQLADLQRKEQALSESNNALKRKLE 172
                                              ***********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.772161IPR002100Transcription factor, MADS-box
SMARTSM004322.6E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-33284IPR002100Transcription factor, MADS-box
CDDcd002652.92E-44276No hitNo description
PRINTSPR004047.8E-32323IPR002100Transcription factor, MADS-box
PfamPF003192.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-323859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-2783171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.33287177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0048481Biological Processplant ovule development
GO:0048833Biological Processspecification of floral organ number
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKQYEFCSS  60
SSMLKTLERY QKCNYGTQET TVSTKETQSS QQEYLRLKAH FEALQRSQRN LLGEDLGPLS  120
GKELEQLEQQ LDMSLKQIRS IKTQYMIDQL ADLQRKEQAL SESNNALKRK LEAAGGWDST  180
GHQMEYNRQP AQAQADNFFH PLECDPTLQI GYPSGYPNPI TVAAPGPSVT NFMPWMAGIE  240
G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A2e-33751711101Developmental protein SEPALLATA 3
4ox0_B2e-33751711101Developmental protein SEPALLATA 3
4ox0_C2e-33751711101Developmental protein SEPALLATA 3
4ox0_D2e-33751711101Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00605ChIP-seqTransfer from AT1G24260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9255020.0KF925502.1 Amborella trichopoda putative MADS-domain transcription factor AGL9 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001292763.10.0agamous-like MADS-box protein AGL9 homolog
SwissprotQ034891e-122AGL9_PETHY; Agamous-like MADS-box protein AGL9 homolog
TrEMBLW1PRJ90.0W1PRJ9_AMBTC; Putative MADS-domain transcription factor AGL9
STRINGGSMUA_Achr9P01370_0011e-117(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.11e-103MIKC_MADS family protein
Publications ? help Back to Top
  1. Zahn LM, et al.
    The evolution of the SEPALLATA subfamily of MADS-box genes: a preangiosperm origin with multiple duplications throughout angiosperm history.
    Genetics, 2005. 169(4): p. 2209-23
    [PMID:15687268]
  2. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]
  3. Melzer R, et al.
    DEF- and GLO-like proteins may have lost most of their interaction partners during angiosperm evolution.
    Ann. Bot., 2014. 114(7): p. 1431-43
    [PMID:24902716]